Which vendors sell Cagrilintide with independent COA testing?

34 vendors in the Merit Verified directory have independent COA evidence on file for Cagrilintide — 143 COAs total. COA coverage and test dates are listed on the Cagrilintide page at https://meritverified.org/peptides/cagrilintide.

How do I verify the quality of Cagrilintide from a vendor?

To verify Cagrilintide quality, look for an independent certificate of analysis (COA) from a third-party lab — not a lab the vendor owns or pays directly. The COA should state the tested compound, lot number, purity percentage (identity and concentration), and the lab's name. Cross-reference the lot number against the vendor's current stock. Merit Verified indexes COAs for Cagrilintide at https://meritverified.org/peptides/cagrilintide so you can compare evidence across vendors before buying.

What is the regulatory status of Cagrilintide?

Cagrilintide is tracked in the Merit Verified registry. Regulatory status for research peptides in the US has been evolving — the FDA has reclassified a number of peptides out of the 503A compounding ingredient list since 2025. Merit Verified does not provide legal or regulatory advice; check official FDA sources or consult a licensed professional for the current status of Cagrilintide in your jurisdiction.

GLP-1 / Metabolic

Cagrilintide

Also known as: NN9838

Cagrilintide is a long-acting acylated amylin analog developed by Novo Nordisk. It is investigational and not FDA-approved; Novo Nordisk's lead development path is the CagriSema co-formulation with semaglutide for weight management. Monotherapy cagrilintide was evaluated in Phase 2 but was deprioritized in favor of the combination.

Where to buy · live market data

Who's worth your money for Cagrilintide

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Top Merit pick

🇺🇸 Glacier Aminos 99

Highest Merit Score (99) of 21 scored sellers

$5.70/mg

$56.99 · 10mg · 99.9% purity

6 COAs

Buy code MERIT · 10% off

Best value

🇺🇸 Sunrise Bioresearch 88

Lowest $/mg among scored sellers

$0.87/mg

$43.50 · 50mg

no COAs yet

Buy

Most tested

🇺🇸 EZ Peptides 85

10 independent COAs on file

$8.80/mg

$44.00 · 5mg · 99.9% purity

10 COAs

Buy

Average price

$13.20/mg

range $0.87–$40.00/mg

Sellers

from $10.00

45-day trend

-3.7%

vs 45-day avg $/mg

58 of 70 sellers have a current price· 34 stale hidden· 3 unverified hidden

	Vendor	Price	$/mg	vs avg	Purity	COAs	Merit
🇺🇸	Glacier Aminos ✓ verified at source · just now	$56.99· 10mg	$5.70/mg	-56.8%	99.9%	6	99	Buy code MERIT · 10% off
🇺🇸	Moglabs ✓ verified at source · just now	$82.00· 10mg	$8.20/mg	-37.9%	—	1	96	Buy
🇺🇸	Licensed Peptides ✓ verified at source · just now	$108· 10mg	$10.80/mg	-18.2%	99.2%	3	95	Buy code MERIT · 5% off
🇺🇸	Forge Performance Co. ✓ verified at source · just now	$70.00· 10mg	$7.00/mg	-47%	99.8%	1	94	Buy code MERIT · 10% off
🇺🇸	Peptide Crafters ✓ verified at source · just now	$65.00· 5mg	$13.00/mg	-1.5%	99.8%	6	94	Buy code CRAFTERS10 · 10% off
🇺🇸	Polaris Peptides ✓ verified at source · just now	$80.00· 5mg	$16.00/mg	+21.2%	100.0%	2	90	Buy
🇺🇸	Peptide Plugs ✓ verified at source · just now	$60.00· 10mg	$6.00/mg	-54.5%	99.6%	2	89	Buy
🇺🇸	Soma Peptides ✓ verified at source · just now	$124· 10mg	$12.40/mg	-6.1%	100.0%	2	89	Buy
🇺🇸	Sunrise Bioresearch ✓ verified at source · just now	$43.50· 50mg	$0.87/mg	-93.4%	—	—	88	Buy
🇺🇸	Ruo Bio ✓ verified at source · just now	$84.00· 10mg	$8.40/mg	-36.4%	99.8%	2	88	Buy

Top Merit pick

🇺🇸 Glacier Aminos
✓ verified at source · just now
99

$5.70/mg -56.8% vs avg

$56.99

10mg

99.9% purity 6 COAs

Buy code MERIT · 10% off
🇺🇸 Moglabs
✓ verified at source · just now
96

$8.20/mg -37.9% vs avg

$82.00

10mg

no purity 1 COA

Buy
🇺🇸 Licensed Peptides
✓ verified at source · just now
95

$10.80/mg -18.2% vs avg

$108

10mg

99.2% purity 3 COAs

Buy code MERIT · 5% off
🇺🇸 Forge Performance Co.
✓ verified at source · just now
94

$7.00/mg -47% vs avg

$70.00

10mg

99.8% purity 1 COA

Buy code MERIT · 10% off
🇺🇸 Peptide Crafters
✓ verified at source · just now
94

$13.00/mg -1.5% vs avg

$65.00

5mg

99.8% purity 6 COAs

Buy code CRAFTERS10 · 10% off
🇺🇸 Polaris Peptides
✓ verified at source · just now
90

$16.00/mg +21.2% vs avg

$80.00

5mg

100.0% purity 2 COAs

Buy
🇺🇸 Peptide Plugs
✓ verified at source · just now
89

$6.00/mg -54.5% vs avg

$60.00

10mg

99.6% purity 2 COAs

Buy
🇺🇸 Soma Peptides
✓ verified at source · just now
89

$12.40/mg -6.1% vs avg

$124

10mg

100.0% purity 2 COAs

Buy
🇺🇸 Sunrise Bioresearch
✓ verified at source · just now
88

$0.87/mg -93.4% vs avg

$43.50

50mg

no purity

Buy
🇺🇸 Ruo Bio
✓ verified at source · just now
88

$8.40/mg -36.4% vs avg

$84.00

10mg

99.8% purity 2 COAs

Buy

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch Cagrilintide

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About Cagrilintide

CAS

1415456-99-3

Molecular formula

C194H312N54O59S2

Sequence

KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Typical dose range

0.3–4.5 mg once weekly subcutaneous (Phase 2); 2.4 mg/week maintenance in Phase 3 REDEFINE/REIMAGINE trials

Half-life

~159–195 hours (~7–8 days)

Independent evidence

COAs for Cagrilintide

143 third-party tests across 34 vendors. Each card links to the full report.

All 143 COAs for Cagrilintide →

Measured purity over time

Cagrilintide

Who's worth your money for Cagrilintide

Watch Cagrilintide

About Cagrilintide

COAs for Cagrilintide

20 citations indexed for Cagrilintide

Maximizing weight loss with cagrisema: a systematic review and GRADE-assessed meta-analysis of randomized controlled trials

Comparative Effectiveness of CagriSegma, Semaglutide, Cagrilintide and Tirzepatide in the Management of Overweight and Obesity: A Network Meta-Analysis of Randomized Clinical Trials

Efficacy and safety of once-weekly cagrilintide-semaglutide (CagriSema) in adults with type 2 diabetes inadequately controlled on diet and exercise (REIMAGINE 1): a randomised, double-blind, placebo-controlled, phase 3a study

Cagrilintide-semaglutide (CagriSema) as an add-on to basal insulin in adults with type 2 diabetes (REIMAGINE 3): a randomised, double-blind, placebo-controlled, multicentre, phase 3 study

Amylin-based obesity therapy: a meta-analysis of Cagrilintide and CagriSema versus placebo

Cagrilintide-semaglutide (CagriSema) versus semaglutide or cagrilintide in people with type 2 diabetes (REIMAGINE 2): a double-blind, randomised, controlled, phase 3 study