Which vendors sell Cagrilintide with independent COA testing?

36 vendors in the Merit Verified directory have independent COA evidence on file for Cagrilintide — 150 COAs total. COA coverage and test dates are listed on the Cagrilintide page at https://meritverified.org/peptides/cagrilintide.

How do I verify the quality of Cagrilintide from a vendor?

To verify Cagrilintide quality, look for an independent certificate of analysis (COA) from a third-party lab — not a lab the vendor owns or pays directly. The COA should state the tested compound, lot number, purity percentage (identity and concentration), and the lab's name. Cross-reference the lot number against the vendor's current stock. Merit Verified indexes COAs for Cagrilintide at https://meritverified.org/peptides/cagrilintide so you can compare evidence across vendors before buying.

What is the regulatory status of Cagrilintide?

Cagrilintide is tracked in the Merit Verified registry. Regulatory status for research peptides in the US has been evolving — the FDA has reclassified a number of peptides out of the 503A compounding ingredient list since 2025. Merit Verified does not provide legal or regulatory advice; check official FDA sources or consult a licensed professional for the current status of Cagrilintide in your jurisdiction.

GLP-1 / Metabolic

Cagrilintide

Also known as: NN9838

Cagrilintide is a long-acting acylated amylin analog developed by Novo Nordisk. It is investigational and not FDA-approved; Novo Nordisk's lead development path is the CagriSema co-formulation with semaglutide for weight management. Monotherapy cagrilintide was evaluated in Phase 2 but was deprioritized in favor of the combination.

Where to buy · live market data

Who's worth your money for Cagrilintide

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Top Merit pick

🇺🇸 Peptide Partners 99

Highest Merit Score (99) of 31 scored sellers

$5.25/mg

$1050 · 200mg · 99.7% purity

17 COAs

Buy

Best value after code

S1 Research 37

$1.98/mg effective with 10% code

$2.20/mg

$22.00 · 10mg

no COAs yet

Buy Code merit · 10% off

Most tested

🇺🇸 EZ Peptides 85

10 independent COAs on file

$8.80/mg

$44.00 · 5mg · 99.9% purity

10 COAs

Buy

Average price

$11.80/mg

range $2.00–$38.00/mg

Sellers

from $10.00

45-day trend

-14.4%

vs 45-day avg $/mg

45 of 52 sellers have a current price· 5 stale hidden· 9 unverified hidden

	Vendor	Price	$/mg	vs avg	Purity	COAs	Merit
🇺🇸	Peptide Partners via Disclosed Labs · just now	$1050· 200mg	$5.25/mg	-55.5%	99.7%	17	99	Buy
🇺🇸	Glacier Aminos ✓ verified at source · 1h ago	$56.99· 10mg	$5.70/mg	-51.7%	99.9%	6	99	Buy Code MERIT · 10% off
🇺🇸	Moglabs via Disclosed Labs · just now	$82.00· 10mg	$8.20/mg	-30.5%	99.9%	2	98	Buy
🇺🇸	BioLongevity Labs via Disclosed Labs · just now	$170· 5mg	$34.00/mg	+188.1%	99.6%	6	96	Buy Code MERIT · 15% off
🇺🇸	Sunrise Bioresearch via Disclosed Labs · just now	$249· 100mg	$2.49/mg	-78.9%	99.6%	1	95	Buy
🇺🇸	Reta One Labs via Disclosed Labs · just now	$89.00· 20mg	$4.45/mg	-62.3%	—	—	95	Buy affiliate
🇺🇸	Profound Aminos via Disclosed Labs · just now	$83.00· 10mg	$8.30/mg	-29.7%	99.9%	3	95	Buy
🇺🇸	Orbitrex Peptides via Disclosed Labs · just now	$89.99· 10mg	$9.00/mg	-23.8%	99.9%	1	95	Buy Code Orbitrex10 · 10% off
🇺🇸	Licensed Peptides ✓ verified at source · 1h ago	$108· 10mg	$10.80/mg	-8.5%	99.2%	3	95	Buy Code MERIT · 5% off
🇺🇸	Forge Performance Co. via Disclosed Labs · just now	$70.00· 10mg	$7.00/mg	-40.7%	99.8%	1	94	Buy Code MERIT · 10% off

Top Merit pick

🇺🇸 Peptide Partners
via Disclosed Labs · just now
99

$5.25/mg -55.5% vs avg

$1050

200mg

99.7% purity 17 COAs

Buy
🇺🇸 Glacier Aminos
✓ verified at source · 1h ago
99

$5.70/mg -51.7% vs avg

$56.99

10mg

99.9% purity 6 COAs

Buy Code MERIT · 10% off
🇺🇸 Moglabs
via Disclosed Labs · just now
98

$8.20/mg -30.5% vs avg

$82.00

10mg

99.9% purity 2 COAs

Buy
🇺🇸 BioLongevity Labs
via Disclosed Labs · just now
96

$34.00/mg +188.1% vs avg

$170

5mg

99.6% purity 6 COAs

Buy Code MERIT · 15% off
🇺🇸 Sunrise Bioresearch
via Disclosed Labs · just now
95

$2.49/mg -78.9% vs avg

$249

100mg

99.6% purity 1 COA

Buy
🇺🇸 Reta One Labs
via Disclosed Labs · just now
95

$4.45/mg -62.3% vs avg

$89.00

20mg

no purity

Buy affiliate
🇺🇸 Profound Aminos
via Disclosed Labs · just now
95

$8.30/mg -29.7% vs avg

$83.00

10mg

99.9% purity 3 COAs

Buy
🇺🇸 Orbitrex Peptides
via Disclosed Labs · just now
95

$9.00/mg -23.8% vs avg

$89.99

10mg

99.9% purity 1 COA

Buy Code Orbitrex10 · 10% off
🇺🇸 Licensed Peptides
✓ verified at source · 1h ago
95

$10.80/mg -8.5% vs avg

$108

10mg

99.2% purity 3 COAs

Buy Code MERIT · 5% off
🇺🇸 Forge Performance Co.
via Disclosed Labs · just now
94

$7.00/mg -40.7% vs avg

$70.00

10mg

99.8% purity 1 COA

Buy Code MERIT · 10% off

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch Cagrilintide

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About Cagrilintide

CAS

1415456-99-3

Molecular formula

C194H312N54O59S2

Sequence

KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Typical dose range

0.3–4.5 mg once weekly subcutaneous (Phase 2); 2.4 mg/week maintenance in Phase 3 REDEFINE/REIMAGINE trials

Half-life

~159–195 hours (~7–8 days)

Independent evidence

COAs for Cagrilintide

150 third-party tests across 36 vendors. Each card links to the full report.

All 150 COAs for Cagrilintide →

Measured purity over time

Cagrilintide

Who's worth your money for Cagrilintide

Watch Cagrilintide

About Cagrilintide

COAs for Cagrilintide

20 citations indexed for Cagrilintide

Efficacy and Safety of CagriSema for Metabolic Outcomes: Systematic Review and Pairwise Meta-Analysis of Randomized Controlled Trials

Amylin-based obesity therapy: a meta-analysis of Cagrilintide and CagriSema versus placebo

Maximizing weight loss with cagrisema: a systematic review and GRADE-assessed meta-analysis of randomized controlled trials

Comparative Effectiveness of CagriSegma, Semaglutide, Cagrilintide and Tirzepatide in the Management of Overweight and Obesity: A Network Meta-Analysis of Randomized Clinical Trials

Efficacy and safety of once-weekly cagrilintide-semaglutide (CagriSema) in adults with type 2 diabetes inadequately controlled on diet and exercise (REIMAGINE 1): a randomised, double-blind, placebo-controlled, phase 3a study

Renal or Hepatic Impairment Does Not Affect Pharmacokinetics, Safety, or Tolerability of Subcutaneous Cagrilintide