For research use only. Not for human consumption. Not medical advice — consult a licensed clinician.

Growth Hormone Secretagogues

CJC-1295

Also known as: CJC-1295 with DAC

CJC-1295 is a synthetic tetrasubstituted analog of growth hormone-releasing hormone (GHRH 1-29) originally developed by ConjuChem. The name historically refers to the DAC-modified (Drug Affinity Complex) form that covalently binds serum albumin, producing a 6–8 day half-life; a separate no-DAC form (also called Modified GRF 1-29) shares the same tetrasubstituted backbone but lacks the albumin-linking maleimidopropionyl-lysine and has a half-life of roughly 30 minutes. Not FDA-approved in any form; ConjuChem halted Phase 2 development around 2007 after a patient death in an HIV-lipodystrophy trial (ultimately judged by investigators to be unrelated to the drug, but development was terminated regardless).

Where to buy · live market data

Who's worth your money for CJC-1295

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Top Merit pick

Highest Merit Score (99) of 28 scored sellers

$5.70/mg

$56.99 · 10mg · 99.9% purity

2 COAs
Buy code MERIT · 10% off

Best value

Lowest $/mg among scored sellers

$0.46/mg

$44.99 · 98mg · 99.6% purity

Most tested

44 independent COAs on file

$5.04/mg

$25.20 · 5mg · 99.5% purity

Average price

$11.59/mg

Sellers

73

45-day trend

+10.7%

54 of 73 sellers have a current price· 18 stale hidden· 8 unverified hidden

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch CJC-1295

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About CJC-1295

CAS

446262-90-4

Molecular formula

C165H269N47O46

Sequence

YADAIFTQSYRKVLAQLSARKLLQDILSRK

Typical dose range

1–2 mg/week subcutaneous (research protocols); published human RCTs used 30–120 mcg/kg single injection

Half-life

~6–8 days (human; albumin-bound via DAC)

Independent evidence

COAs for CJC-1295

184 third-party tests across 31 vendors. Each card links to the full report.

All 184 COAs for CJC-1295 →
Measured purity 58.8%–100.0% across 131 COAs
Measured purity over time
✓ Vendor-published
99.41 %
Jul 2026
Kovera Labs

For

CJC-1295 no DAC

by Ignite Peptides· batch IP-2607-040

COA on file
✓ Vendor-published
98.94 %
Jun 2026
ILS Laboratories

For

CJC-1295 NO DAC

by Ion Peptide· batch CND10-06102026

COA on file
✓ Vendor-published
99.63 %
Jun 2026
ILS Laboratories

For

CJC-1295 NO DAC

by Ion Peptide· batch CDN5-06092026

COA on file
✓ Vendor-published
99.89 %
Jun 2026
TrustPointe Analytics Moderate

For

CJC-1295 (No DAC)

by Peptide Partners· batch SPL-4140

COA on file
✓ Vendor-published
99.65 %
Jun 2026
Kovera Labs

For

CJC-1295 no DAC

by Peptide Partners· batch CJ202606

COA on file
Aggregated · 3rd-party listing
99.59 %
Jun 2026
Janoshik Analytical Limited

For

CJC-1295 No DAC

by EZ Peptides· batch EZP-CJC0505232026-05

✓ Vendor-published
99.09 %
Jun 2026
Janoshik Analytical Limited

For

CJC-1295 No DAC

by EZ Peptides· batch EZP-CJC0505232026-05

COA on file
✓ Vendor-published
99.69 %
Jun 2026
ILS Laboratories

For

CJC-1295 (No Dac) + Ipamorelin

by Forge Performance Co.· batch Copper band / Pink Cap

COA on file
Aggregated · 3rd-party listing
99.41 %
Jun 2026
Kovera Labs

For

CJC-1295 no DAC

by Real Peptides· batch RP052226

Aggregated · 3rd-party listing
99.76 %
May 2026
Freedom Diagnostics Moderate

For

CJC-1295

by Peptide Supply Co.· batch CJC05192026

Aggregated · 3rd-party listing
99.00 %
May 2026
Ethos Analytics Strong · HPLC

For

CJC-1295 without DAC

by OROS Research· batch OR-LP-CJCND5-526-B5

✓ Vendor-published
99.87 %
May 2026
Kovera Labs

For

CJC-1295 (No DAC)/Ipamorelin

by Ion Peptide· batch CP10-05142026

COA on file
Aggregated · 3rd-party listing
99.46 %
May 2026
Janoshik Analytical Limited · HPLC

For

CJC-1295 DAC

by Verified Peptides· batch CJD06261105J

Aggregated · 3rd-party listing
99.46 %
May 2026
Janoshik Analytical Limited

For

CJC-1295 DAC

by Verified Peptides· batch CJD06261105J

✓ Vendor-published
99.05 %
May 2026
Vanguard Laboratory Strong

For

CJC-1295 no DAC/Ipamorelin

by Licensed Peptides· batch White Cap

COA on file
✓ Vendor-published
99.42 %
May 2026
ILS Laboratories

For

CJC-1295 + DAC

by Ion Peptide· batch COA-2026-JMWO_D

COA on file
✓ Vendor-published
99.83 %
May 2026
Kovera Labs

For

CJC-1295 no DAC/Ipamorelin/Tesamorelin

by Peptide Partners· batch CIT202604

COA on file
Aggregated · 3rd-party listing
99.66 %
May 2026
Janoshik Analytical Limited

For

CJC-1295 DAC

by Verified Peptides

Aggregated · 3rd-party listing
99.46 %
May 2026
Janoshik Analytical Limited · HPLC

For

CJC-1295 DAC

by Verified Peptides· batch CJD06261105J

Aggregated · 3rd-party listing
99.78 %
Apr 2026
Freedom Diagnostics Moderate

For

CJC-1295

by Modern Research Peptides· batch WCHK11102

Aggregated · 3rd-party listing
99.83 %
Apr 2026
Janoshik Analytical Limited · HPLC

For

CJC-1295 No DAC

by Verified Peptides· batch cmp4wgbak004gx7rxaulax2wm

✓ Vendor-published
99.83 %
Apr 2026
Janoshik Analytical Limited

For

CJC-1295 No DAC

by Verified Peptides· batch CJND052609101

COA on file
✓ Vendor-published
99.80 %
Apr 2026
Kovera Labs

For

CJC-1295 (No DAC)/Ipamorelin

by Ion Peptide· batch CP10-04172026

COA on file
Aggregated · 3rd-party listing
99.26 %
Apr 2026
Janoshik Analytical Limited

For

CJC-1295 with DAC

by Reta Peptide· batch 20260409

Research depth

14 citations indexed for CJC-1295

All research on CJC-1295 →

Study · 2026

Peptide Supplements and Their Therapeutic Applications in Sports Medicine

Background The peptide supplement market has experienced rapid growth due to marketing claims of enhanced performance and accelerated recovery from musculoskeletal injury.

review · 2026

The emerging landscape of performance-enhancing peptides modulating GH-IGF1 axis: bridging the gap between clinical evidence and patient self-administration

Performance-enhancing drugs (PEDs) marketed as "research compounds" include unregulated peptides intended to modulate the growth hormone-insulin-like growth factor-1 (GH-IGF-1) axis.

review · 2026

Therapeutic peptides in gerontology: mechanisms and applications for healthy aging

Background Peptide therapeutics represent an emerging frontier in gerontological medicine, targeting fundamental hallmarks of aging including metabolic dysfunction, telomere attrition, tissue repair impairment, and hormonal decline.

review · 2026

Injectable Peptide Therapy: A Primer for Orthopaedic and Sports Medicine Physicians

Background Therapeutic peptides are short-chain amino acids that regulate cellular functions and facilitate biochemical processes. In recent years, there has been significant growth in the global market for therapeutic peptides and thus its popularity among patients.

review · 2026

Safety and Efficacy of Approved and Unapproved Peptide Therapies for Musculoskeletal Injuries and Athletic Performance

Peptides are short chains of amino acids with a unique pharmacological niche between small-molecule drugs and large proteins. Their use in sports medicine is rapidly expanding, driven by patient demand for accelerated injury recovery and performance enhancement.

review · 2026

Injectable Peptides in Sports Medicine: A Structured Narrative Review of Evidence, Safety, and Antidoping Implications

Background Injectable peptides are increasingly promoted for musculoskeletal recovery, tissue repair, and performance enhancements; however, clinical adoption has outpaced high-quality evidence and regulatory consensus.