For research use only. Not for human consumption. Not medical advice — consult a licensed clinician.

GLP-1 / Metabolic

Liraglutide

Also known as: Victoza

Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).

Where to buy · live market data

Who's worth your money for Liraglutide

Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.

Average price

$3.33/mg

Sellers

1

45-day trend

-71.4%

1 of 1 sellers have a current price· 1 stale hidden

  • No fresh prices — all 1 listing are older than 7 days.

Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.

Watch Liraglutide

Get one email when the market actually moves — no newsletter, no noise.

Compound reference

About Liraglutide

CAS

204656-20-2

Molecular formula

C172H265N43O51

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR

Typical dose range

0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management)

Half-life

~13 hours

Independent evidence

No COAs on file for Liraglutide

No independent third-party test has been located or submitted yet. Absence isn't a red flag — just no evidence catalogued for Liraglutide so far; we add COAs as we find them.

Research depth

20 citations indexed for Liraglutide

All research on Liraglutide →

Study · 2026

Psychiatric and eye disorders associated with use of glucagon-like peptide 1 receptor agonists (GLP-1 RAs)

Glucagon-like peptide 1 receptor agonists (GLP-1 RAs) semaglutide, liraglutide, and dulaglutide are indicated for diabetes. Semaglutide and liraglutide were also approved for therapy of obesity or weight control. Apprehension has been expressed about the possible link between GLP-1 RAs and suicidality.

Study · 2026

Economic evaluation of liraglutide versus sitagliptin in the treatment of type 2 diabetes mellitus inadequately controlled with metformin

Objective To assess the long-term economic value of liraglutide compared with sitagliptin among patients with type 2 diabetes mellitus (T2DM) who fail to achieve adequate glycemic control with metformin monotherapy. Methods A Markov model based on China's health system was constructed.

case-report · 2026

Successful Reversal of Tamoxifen-Associated Weight Gain and Metabolic Dysfunction with Liraglutide in a Breast Cancer Survivor: A Case Report

Introduction: Adjuvant endocrine therapy for breast cancer - particularly tamoxifen - is commonly associated with weight gain, increased adiposity, and metabolic dysfunction. Lifestyle measures often fail to reverse these effects.

Study · 2026

Liraglutide and Βeta-Cell Function in Young Adults With Long-Standing Type 1 Diabetes and Residual C-Peptide: A Blinded, Randomized Controlled Trial

Aims To evaluate the effect of liraglutide on residual beta-cell function in adults with long-standing type 1 diabetes (T1D) and detectable C-peptide.

animal · 2026

Effects of liraglutide on gut bacterial community dynamics

Liraglutide, a GLP-1 receptor agonist, is used to induce weight loss. However, limited information exists on liraglutide's effects on the gut bacterial community and their restoration after washout.

animal · 2026

Liraglutide affects mitochondrial function and histone acetylation through the NQO1/SIRT3 pathway in diabetic kidney disease

Diabetic kidney disease (DKD) is a major microvascular complication of diabetes. The glucagon-like peptide-1 receptor agonist (GLP-1RA) liraglutide exerts renoprotective effects beyond glucose control; however, the underlying mechanisms remain incompletely understood.