Liraglutide
Also known as: Victoza
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Who's worth your money for Liraglutide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Average price
$3.33/mg
Sellers
1
45-day trend
-71.4%
1 of 1 sellers have a current price· 1 stale hidden
- No fresh prices — all 1 listing are older than 7 days.
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Liraglutide
Get one email when the market actually moves — no newsletter, no noise.
About Liraglutide
CAS
204656-20-2
Molecular formula
C172H265N43O51
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR
Typical dose range
0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management)
Half-life
~13 hours
No COAs on file for Liraglutide
No independent third-party test has been located or submitted yet. Absence isn't a red flag — just no evidence catalogued for Liraglutide so far; we add COAs as we find them.
20 citations indexed for Liraglutide
Study · 2026
Psychiatric and eye disorders associated with use of glucagon-like peptide 1 receptor agonists (GLP-1 RAs)
Glucagon-like peptide 1 receptor agonists (GLP-1 RAs) semaglutide, liraglutide, and dulaglutide are indicated for diabetes. Semaglutide and liraglutide were also approved for therapy of obesity or weight control. Apprehension has been expressed about the possible link between GLP-1 RAs and suicidality.
Study · 2026
Economic evaluation of liraglutide versus sitagliptin in the treatment of type 2 diabetes mellitus inadequately controlled with metformin
Objective To assess the long-term economic value of liraglutide compared with sitagliptin among patients with type 2 diabetes mellitus (T2DM) who fail to achieve adequate glycemic control with metformin monotherapy. Methods A Markov model based on China's health system was constructed.
case-report · 2026
Successful Reversal of Tamoxifen-Associated Weight Gain and Metabolic Dysfunction with Liraglutide in a Breast Cancer Survivor: A Case Report
Introduction: Adjuvant endocrine therapy for breast cancer - particularly tamoxifen - is commonly associated with weight gain, increased adiposity, and metabolic dysfunction. Lifestyle measures often fail to reverse these effects.
Study · 2026
Liraglutide and Βeta-Cell Function in Young Adults With Long-Standing Type 1 Diabetes and Residual C-Peptide: A Blinded, Randomized Controlled Trial
Aims To evaluate the effect of liraglutide on residual beta-cell function in adults with long-standing type 1 diabetes (T1D) and detectable C-peptide.
animal · 2026
Effects of liraglutide on gut bacterial community dynamics
Liraglutide, a GLP-1 receptor agonist, is used to induce weight loss. However, limited information exists on liraglutide's effects on the gut bacterial community and their restoration after washout.
animal · 2026
Liraglutide affects mitochondrial function and histone acetylation through the NQO1/SIRT3 pathway in diabetic kidney disease
Diabetic kidney disease (DKD) is a major microvascular complication of diabetes. The glucagon-like peptide-1 receptor agonist (GLP-1RA) liraglutide exerts renoprotective effects beyond glucose control; however, the underlying mechanisms remain incompletely understood.