Liraglutide
Also known as: Victoza
Liraglutide is an FDA-approved GLP-1 receptor agonist marketed as Victoza (type 2 diabetes, approved 2010) and Saxenda (chronic weight management, approved 2014). It was the first GLP-1 analog approved for obesity and carries an FDA boxed warning for the risk of thyroid C-cell tumors. Pediatric indications include type 2 diabetes in patients ≥10 years (Victoza) and obesity in patients ≥12 years with BMI ≥95th percentile (Saxenda).
Who's worth your money for Liraglutide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Average price
$3.33/mg
Sellers
1
45-day trend
building…
1 of 1 sellers have a current price· 1 stale hidden
- No fresh prices — all 1 listing are older than 7 days.
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Liraglutide
Get one email when the market actually moves — no newsletter, no noise.
About Liraglutide
CAS
204656-20-2
Molecular formula
C172H265N43O51
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVRGR
Typical dose range
0.6–1.8 mg/day subcutaneous (diabetes); 0.6–3.0 mg/day subcutaneous (obesity/weight management)
Half-life
~13 hours
No COAs on file for Liraglutide
No independent third-party test has been located or submitted yet. Absence isn't a red flag — just no evidence catalogued for Liraglutide so far; we add COAs as we find them.
20 citations indexed for Liraglutide
animal · 2026
Effects of Liraglutide and Semaglutide on Cardiometabolic Dysregulation and Oxidative Stress in an Experimental Model of Metabolic Syndrome
Background/objectives Metabolic syndrome (MetS) increases susceptibility to myocardial ischemia/reperfusion (I/R) injury through metabolic disturbance, hypertension, and oxidative stress.
Study · 2026
Parabrachial CGRP neurons mediate incretin-induced aversion and anti-aversion, but not anorexia or weight loss
Incretin mimetics such as the glucagon-like peptide-1 receptor agonist (GLP-1RA) liraglutide cause decreased food intake, weight loss, and aversion. Here, we examined the extent to which parabrachial calcitonin gene-related peptide (CGRP) neurons contribute to these effects.
review · 2026
Comparative Efficacy and Safety of Liraglutide Versus Metformin in Women With Polyendocrine Metabolic Ovarian Syndrome (PMOS): A Systematic Review and Meta-Analysis of Randomized Controlled Trials
Polyendocrine metabolic ovarian syndrome (PMOS), previously known by the name 'polycystic ovary syndrome (PCOS),' is a common and complex endocrine-metabolic disorder affecting approximately one in eight women. PMOS is increasingly regarded as a multisystem disorder rather than only a gynaecological condition.
Study · 2026
Liraglutide use in congenital generalized lipodystrophy: glycemic and metabolic outcomes
Objective Evidence on glucagon-like peptide 1 receptor agonists (GLP-1RAs) in lipodystrophies is limited. We evaluated the effects of liraglutide on metabolic control and satiety in patients with congenital generalized lipodystrophy (CGL).
animal · 2026
Liraglutide Ameliorates Atrial Fibrillation in Association with Enhanced Adiponectin Signaling in Epicardial Adipose Tissue
Purpose Atrial fibrillation (AF) is associated with obesity and epicardial adipose tissue (EAT) dysfunction.
animal · 2026
Study on the Regulatory Mechanism of GLP-1 Receptor Agonist Liraglutide in Diabetic Corneal Epithelial Wound Healing
Purpose The purpose of this study was to elucidate the effects and mechanisms of liraglutide in repairing diabetic corneal epithelial injury, explore its therapeutic advantages, and provide experimental evidence for clinical application.