Teriparatide
Also known as: PTH 1-34, Parathyroid Hormone (1-34), rhPTH(1-34), Forteo, Bonsity
Recombinant human parathyroid hormone fragment consisting of the biologically active N-terminal 34 amino acids of endogenous PTH (PTH 1-34). It is a PTH1 receptor (PTH1R) agonist; when administered as a once-daily intermittent injection it preferentially stimulates osteoblast-mediated bone formation, increasing bone mineral density and reducing fracture risk. Teriparatide is FDA-approved (originally as Forteo, approved 2002) for osteoporosis at high fracture risk in postmenopausal women, men, and glucocorticoid-induced osteoporosis, and was the first anabolic (bone-building) osteoporosis therapy. It is one of the few peptides in this directory with full FDA marketing approval.
Who's worth your money for Teriparatide
Every current seller, ranked by independent evidence — Merit Score, latest COA purity, and live $/mg (size-normalized). Prices refresh daily. Rankings are never paid.
Average price
—/mg
Sellers
3
45-day trend
building…
0 of 3 sellers have a current price
Prices observed from public storefronts (last 24h), normalized to $/mg. "Evidence" is Merit's 0–100 Merit Score, derived only from observable verification evidence (methodology on /about); "Purity" is the latest independent COA. Some buy links are affiliate links — Merit may earn a commission at no extra cost to you, and where a vendor offers one, the code shown gets you a discount at their checkout. Affiliate status never affects price data, ranking, or the Merit Score (full policy on /disclosure). Research use only.
Watch Teriparatide
Get one email when the market actually moves — no newsletter, no noise.
About Teriparatide
CAS
52232-67-4
Molecular formula
C181H291N55O51S2
Sequence
SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
Typical dose range
20 mcg once daily subcutaneous (approved labeling); maximum cumulative use historically limited to ~2 years
Half-life
~1 hour after subcutaneous injection (serum), though the systemic exposure window is short; longer than after intravenous administration (~5 minutes)
Common research uses
Safety notes
FDA-approved. Labeling carried a boxed warning for osteosarcoma based on rat studies (the 2-year cumulative-use limit and boxed warning were removed by the FDA in 2020 after long-term human data did not show increased osteosarcoma risk). Contraindicated/cautioned in patients at increased baseline osteosarcoma risk (e.g., Paget disease, prior skeletal radiation, unexplained elevated alkaline phosphatase). Common effects include orthostatic hypotension and transient hypercalcemia. Not a WADA-prohibited substance.
Reconstitution
Supplied as a prefilled multi-dose pen; refrigerate (2-8 C), do not freeze, and use within the labeled in-use period after first injection.
COAs for Teriparatide
4 third-party tests across 2 vendors. Each card links to the full report.
For
Teriparatide
by Arcane Peptides
For
Teriparatide
by Arcane Peptides· batch Unknown
For
Teriparatide
by Orbitrex Peptides· batch TERA101225
Purity not on file
For
Teriparatide
by Arcane Peptides
20 citations indexed for Teriparatide
review · 2026
Bone Anabolic Treatment in Patients With Chronic Kidney Disease: A Systematic Review
Background Chronic kidney disease (CKD) associated osteoporosis leads to an increased risk of bone fracture in patients with CKD. Evidence on the efficacy and safety of anti-osteoporotic medications is limited for this group.
animal · 2026
Teriparatide Topical Delivery Supports Osseointegration in Ovariectomized Rats Receiving Cafeteria Diet and Bisphosphonate: An In Vivo Experimental Study
Background Postmenopausal osteoporosis associated with cafeteria diet and bisphosphonate therapy may impair peri-implant bone repair. Therefore, strategies to enhance osseointegration are needed.
case-report · 2026
Contralateral atypical femoral fracture following a single dose of denosumab after incomplete teriparatide therapy in a patient with long-term bisphosphonate exposure: A case report
animal · 2026
Combined Teriparatide and Exercise Effects on Diabetic Skeletal Muscle Ultrastructure
Background/aim The effects of combined teriparatide (TPTD) administration and exercise therapy on diabetic skeletal muscle remain unclear. This study investigated the effects of combined TPTD and treadmill exercise on skeletal muscle and mitochondrial ultrastructure in Akita mice, a model of type 1 diabetes.
Study · 2026
Is teriparatide linked to osteosarcoma? A disproportionality analysis of the FAERS database
Background Teriparatide is approved for the treatment of osteoporosis and is generally well-tolerated. However, concerns remain about a possible association with osteosarcoma, a rare but aggressive bone malignancy.
Study · 2026
Teriparatide treatment of osteoporosis in solid organ transplant recipients-a single-center experience
Solid organ transplant recipients face high fracture risk with limited evidence guiding anabolic therapy. In this real-world cohort, teriparatide was associated with significant improvements in bone mineral density and acceptable safety without adverse graft effects.